Protein coding transcript 1906

• Transcript: Ll_transcript_276026
• CDS coordinates: 2-529 (+)
• Peptide sequence: DNVNCGPGHGMSIGSLGRENTKACVTNVTIRDITLHDTLTGVRIKTHQGGSGSVQDVMFSNIQVSRVETPIIIDQYYCDKGKCQNYTSAVAVSNIHYINVKGTYTKEPVYFACSDNLPCTGITLDTIQLQSSSSEVVPFCWEAYGELKTKTVPPVDCLEKGNPSSIGVQSNKNSC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_276026

• Blastp: Polygalacturonase At1g48100 from Arabidopsis with 50.91% of identity
• Blastx: Polygalacturonase At1g48100 from Arabidopsis with 50.91% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: Link to kegg annotations (AT1G48100)
• CantataDB: Link to cantataDB annotations (CNT0002960)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427342.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;