Protein coding transcript 190652

• Transcript: Ll_transcript_102554
• CDS coordinates: 83-1546 (+)
• Peptide sequence: MAASHLLYHSPSFPKTLNHSLNQNSFARNLVLPLKATFKPLVLRAVLCQSNTAKPQLHDSQSTTNFQHCFTKSEDGFLYCEGVKVHEIMESVDKRPFYLYSKPQITRNVEAYKDALEGLTSIIGYAIKANNNLKILEHLRHLGCGAVLVSGNELRLALRAGFDPKRCIFNGNGKLLEDLVLAAQEGVFINIDSEFDLENIVAAARIAGKRVNVLLRINPDVDPQVHHYVATGNKNSKFGIRNEKLQWFLDAVKEHPNEIKLVGAHCHLGSTITKVDIFRDAATIMVNYIDQIRAQGFEVNYLNIGGGLGIDYHHSGAILPTPRDLIDTVRELVLSRNLNLIIEPGRSLIANTCCLVNRVTGVKTNGSKNFIVIDGSMAELIRPSLYDAYQHIELISPAPANAEVANFDVFGPVCESADFLGKDRQLPTPDKGTGLVVHDAGAYCMSMASTYNLKMRPPEYWVEDNGTVSKIRHGETFEDHIRFFEGL*
• ORF Type: complete

Annotations of Ll_transcript_102554

• Blastp: Diaminopimelate decarboxylase 2, chloroplastic from Arabidopsis with 77.41% of identity
• Blastx: Diaminopimelate decarboxylase 2, chloroplastic from Arabidopsis with 77.41% of identity
• Eggnog: Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine (By similarity)(COG0019)
• Kegg: Link to kegg annotations (AT5G11880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431286.1)
• Pfam: Pyridoxal-dependent decarboxylase, pyridoxal binding domain (PF02784.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;