Transcript | Ll_transcript_103066 |
---|---|
CDS coordinates | 403-1089 (+) |
Peptide sequence | MASLTLSHATPSQLCSGKSGIFSPSKALIVNPLRTQIMKKGKEMRITCQATSIAADRVPDMEKRKLMNLLLLGALSLPTAGMLVPYATFFAPPGSGSSTGGVVAKDALGNDVLAEEWLKAHGPGDRTLTQGLKGDPTYLVVEKDRTLATYGINAVCTHLGCVVPWNKAENKFMCPCHGSQYNDQGRVVRGPAPLVSKLENIVFVLIPPLAYKHSNHQTSYALFLHTFS* |
ORF Type | complete |
Blastp | Cytochrome b6-f complex iron-sulfur subunit, chloroplastic from Pisum with 81.54% of identity |
---|---|
Blastx | Cytochrome b6-f complex iron-sulfur subunit, chloroplastic from Pisum with 81.54% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443128.1) |
Pfam | Cytochrome B6-F complex Fe-S subunit (PF08802.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer