Protein coding transcript 190671

• Transcript: Ll_transcript_103068
• CDS coordinates: 382-1041 (+)
• Peptide sequence: MASTTLSPATPSQLCYGKSGILCPPQALLVKHVRTQIMEKGKGMRVTCQATSIAADRVPDMEKRKLMNLLLLGALSLPTAGMLVPYATFFAPPGSGSSTGGVVAKDALGNDVLAEEWLKTHGPGDRTLTQGLKGDPTYLVVEKDRTLATYGINAVCTHLGCVVPWNKAENKFMCPCHGSQYNDQGRVVRGPAPLSLALSHADVDNGKVLFVPWVETDFRT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_103068

• Blastp: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic from Pisum with 82.06% of identity
• Blastx: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic from Pisum with 81.99% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431083.1)
• Pfam: Cytochrome B6-F complex Fe-S subunit (PF08802.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;