Transcript | Ll_transcript_102608 |
---|---|
CDS coordinates | 344-829 (+) |
Peptide sequence | MESCNCIEPQFPAEELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFTMHSRTVAIVMTTAKILTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRITLDRHTI |
ORF Type | 3prime_partial |
Blastp | Ethylene receptor from Prunus with 96.3% of identity |
---|---|
Blastx | Ethylene receptor from Prunus with 96.3% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004515182.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer