Protein coding transcript 1907

• Transcript: Ll_transcript_276039
• CDS coordinates: 2-415 (+)
• Peptide sequence: FFVYMIMIYMIYDGISCTLVLIKSAMLMKKGIPSEPPLMVKQLMTNPRDCESDNEGLRYQVSEGGMEVGSCEAGTGEGRSGEGMNEWGVLDRLVTSHLGATANEDSSKGVRFEDAPNPHHPLSLRGEIMDFWGYSKQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_276039

• Blastp: Protein BEARSKIN2 from Arabidopsis with 45.54% of identity
• Blastx: Protein BEARSKIN2 from Arabidopsis with 45.54% of identity
• Eggnog: nac domain(ENOG410YF47)
• Kegg: Link to kegg annotations (AT4G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412831.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;