Transcript | Ll_transcript_418707 |
---|---|
CDS coordinates | 88-711 (+) |
Peptide sequence | MSWTCSCVLVLIFVLPFLPFLASPASPIKNLPGYDGVLPFNLQAGYIGVGEGEEVQIFHLFVESQRNPNIDPLLLWFVGGPGCSALSAFFFENGPLRMDRNYGGDIPKLELNPYGWTQRLNMIYVDMPVGTGFSYSKTQQGYYSNDTQWVEHAYSFLQKWFIDHPKFGSNPLYIGGGSYSGLVTGPLVQKVYEGYMARHKPLLNIKV* |
ORF Type | complete |
Blastp | Serine carboxypeptidase-like 1 from Arabidopsis with 50.82% of identity |
---|---|
Blastx | Serine carboxypeptidase-like 1 from Arabidopsis with 50.82% of identity |
Eggnog | carboxy-peptidase(COG2939) |
Kegg | Link to kegg annotations (AT5G36180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454247.1) |
Pfam | Serine carboxypeptidase (PF00450.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer