Protein coding transcript 190775

• Transcript: Ll_transcript_103366
• CDS coordinates: 88-468 (+)
• Peptide sequence: MTRPKIYLFGDSITEESFSLGGWGASLANHFSRTADVVLRGYSGYNTRWVLKVLDKVFPTSSQGGGGDNETEVAPIALTIFFGANDASLSDRCSAFQHVPLHEYKDNLKAIVSFFKVIKLMSCLSL*
• ORF Type: complete

Annotations of Ll_transcript_103366

• Blastp: GDSL esterase/lipase At5g45920 from Arabidopsis with 67.24% of identity
• Blastx: GDSL esterase/lipase At5g45920 from Arabidopsis with 67.24% of identity
• Eggnog: lipolytic protein G-D-S-L family(COG2755)
• Kegg: Link to kegg annotations (AT5G45920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426045.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;