Protein coding transcript 190879

• Transcript: Ll_transcript_102938
• CDS coordinates: 968-1879 (+)
• Peptide sequence: MSSYLVILQGISMGLGPDGELRYPSHHQLPGDTKTRGVGEFQCYDENMLSFLKQHAEASGNPLWGLDGPHDAPTYDQPLHSNNFFKDEGSWESAYGDFFLSWYANQLLTHGDCLLSLAASTFGDTGVEVYGKMPLMHSWYGTRSHPSELTAGFYNTANRDGYEPVAKMFARNSCKMIIPGIDLSDANQSNETHSSPELLLAQIMKSCKNHGVKVSGQNISESGTPGFFEQIKKNLSRDKVMNLFTYQRMGAYFFSPEHFPSFSEFVRSLNQPELHSDDLPSEAEELADSAIKSQESSLSMQTA*
• ORF Type: complete

Annotations of Ll_transcript_102938

• Blastp: Inactive beta-amylase 9 from Arabidopsis with 59.73% of identity
• Blastx: Inactive beta-amylase 9 from Arabidopsis with 59.73% of identity
• Eggnog: Beta-amylase(ENOG410YC8N)
• Kegg: Link to kegg annotations (AT5G18670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439718.1)
• Pfam: Glycosyl hydrolase family 14 (PF01373.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;