Protein coding transcript 1909

• Transcript: Ll_transcript_276062
• CDS coordinates: 105-1028 (+)
• Peptide sequence: MESIGVLMPSPIYGYLEQELAKRFKLFNPSNISEENVNSIRAVVSSAKISVDTQLIESLPKLEIVSTFSVGYDKIDLAKCREKNIRVTNTPDVLSDDVADTAIGLALAVLRKICVGDQYVRNGHWIKSDFPLTTKFSGKAVGIVGLGRIGSAIAKRAAAFGCPISYHSRSEKSESGYKYYPNILDLASNSEVLFVACTLNKETYHIVNRQVIDALGPKGVIINIGRGQHIDQPELVSALSEGRLGGAGVDVFENEPEVPEQLLGLENAVLSPHAASDTVETCNAMADLVLSNLEAHFLNKPLLTPVV*
• ORF Type: complete

Annotations of Ll_transcript_276062

• Blastp: Hydroxyphenylpyruvate reductase from Solenostemon with 66.77% of identity
• Blastx: Hydroxyphenylpyruvate reductase from Solenostemon with 66.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458182.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (PF00389.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;