Protein coding transcript 190966

• Transcript: Ll_transcript_102565
• CDS coordinates: 182-625 (+)
• Peptide sequence: MYHAKKISMSTMVPHQSQCSSEQLANVAILGGSGVKSGAPAEESGKQRLRWTSDLHDHFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRLAKYLPDSSADGKCALFLFPLLPQKDINYKYNDVLISYFKLNLCEFFF*
• ORF Type: complete

Annotations of Ll_transcript_102565

• Blastp: Myb family transcription factor PHL7 from Arabidopsis with 78.67% of identity
• Blastx: Myb family transcription factor PHL7 from Arabidopsis with 50.5% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG4111GBR)
• Kegg: Link to kegg annotations (AT2G01060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457148.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;