Transcript | Ll_transcript_102568 |
---|---|
CDS coordinates | 2423-2788 (+) |
Peptide sequence | MIVQVQQQLQMRIEAQGKYLQKIIEEQQKLGSTLATTETLPSSHDKQNHPQSEPSESSDAFAGALSPLKKQKIDDVSKDGSTASRVPTKNAQKTDCSAGKPDPKLYEDDAGFGFDLDSEKD* |
ORF Type | complete |
Blastp | Myb family transcription factor PHL7 from Arabidopsis with 33.33% of identity |
---|---|
Blastx | Myb family transcription factor PHL7 from Arabidopsis with 63.06% of identity |
Eggnog | Myb-like DNA-binding domain(ENOG4111GBR) |
Kegg | Link to kegg annotations (AT2G01060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429457.1) |
Pfam | MYB-CC type transfactor, LHEQLE motif (PF14379.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer