| Transcript | Ll_transcript_102571 |
|---|---|
| CDS coordinates | 406-762 (+) |
| Peptide sequence | MYHAKKFSASTMVPHKSQGNVEQLENVVVLGGAAMKNATPAGGSGKQRLRWTSDLHDRFVDAITQLGGPDSGYFFSLLSLTQILRQNKIVSVTYHIFDKHVVKRIPFANVTNDAYIPH* |
| ORF Type | complete |
| Blastp | Protein PHR1-LIKE 3 from Arabidopsis with 84% of identity |
|---|---|
| Blastx | Protein PHR1-LIKE 3 from Arabidopsis with 44.83% of identity |
| Eggnog | Myb-like DNA-binding domain(ENOG410YGB1) |
| Kegg | Link to kegg annotations (AT4G13640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429456.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer