Protein coding transcript 191007

• Transcript: Ll_transcript_102646
• CDS coordinates: 592-1116 (+)
• Peptide sequence: MSGQNIEKLRNSSGASVTVLAPNQLPLCASAHESDRVVQLSGDLPAVMKALEEIGYQLRENPPRQVISISPTYNYAAIRPSQPYLDPSSVDYVTFEMLISETMVGGLIGRCGANISRIRNESGAMIKVYGGKGEQKHRQIQFGGSAEQVALAKQRVDEYIYSQLIQQTGPQESG*
• ORF Type: complete

Annotations of Ll_transcript_102646

• Blastp: Poly(rC)-binding protein 4 from Mus with 26.46% of identity
• Blastx: Poly(rC)-binding protein 4 from Homo with 27.91% of identity
• Eggnog: mRNA transport(ENOG410XNN8)
• Kegg: Link to kegg annotations (59092)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434259.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;