Protein coding transcript 191027

• Transcript: Ll_transcript_117326
• CDS coordinates: 2-316 (+)
• Peptide sequence: TWDLKYRHVYIKNGLDNHTILRFRCKSADDDLGTQNLKYDEEFKFQFRPSIFTNTVFHCSFTWDGKYRTFPIYDFKRDENSCHDCYWSIKQNFPCRFDNKTQGYD
• ORF Type: internal

Annotations of Ll_transcript_117326

• Blastp: S-protein homolog 5 from Arabidopsis with 39.36% of identity
• Blastx: S-protein homolog 5 from Arabidopsis with 39.36% of identity
• Eggnog: Plant self-incompatibility protein S1(ENOG411160C)
• Kegg: Link to kegg annotations (AT1G04645)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013468049.1)
• Pfam: Plant self-incompatibility protein S1 (PF05938.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;