Protein coding transcript 191050

• Transcript: Ll_transcript_66998
• CDS coordinates: 2-418 (+)
• Peptide sequence: EELILLDEWLSMFGMRARIALAEKDIEYEYKEEDLTNKSNLLLQMNPIHKKIPVLIHKGKPICESLIIVEYIDEVWKDKVPLLPSDPYEKSQARFWADFVNKKVGEVGGRIWAGKKDEIEVAKKELIEGLKELKWQRRS
• ORF Type: internal

Annotations of Ll_transcript_66998

• Blastp: Probable glutathione S-transferase parC from Nicotiana with 72.39% of identity
• Blastx: Probable glutathione S-transferase parC from Nicotiana with 73.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107823949)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432363.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;