Protein coding transcript 191052

• Transcript: Ll_transcript_67015
• CDS coordinates: 2-412 (+)
• Peptide sequence: EELILLDEWLSMFGMRARIALAEKDIEYEYKEEDLTNKSNLLLQMNPIHKKIPVLIHKGKPICESLIIVEYIDEVWKDKVPLLPSDPYEKSQARFWADFVNKKVGPIFNDFSILFHLHRLIATSKSNLDHCVFFVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_67015

• Blastp: Glutathione S-transferase 3 from Soja with 75% of identity
• Blastx: Glutathione S-transferase 3 from Soja with 75% of identity
• Eggnog: glutathione Stransferase(ENOG410XSIX)
• Kegg: Link to kegg annotations (547925)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432363.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;