Protein coding transcript 191059

• Transcript: Ll_transcript_67017
• CDS coordinates: 1099-1521 (+)
• Peptide sequence: MSFIFINSFLNGPYYAYICGAGEKQQVYDDGKRIWTKKGNEIEVAKKDFINTLKQLEERLGDKPYFGGDTFGFVDLALIPYYTWFYAYEVIGNFKVEAECPKFIAWAERCKQIENVSKSLADEKVVYDFVVALRKRFGLE*
• ORF Type: complete

Annotations of Ll_transcript_67017

• Blastp: Probable glutathione S-transferase from Nicotiana with 64.66% of identity
• Blastx: Glutathione S-transferase 3 from Soja with 73.91% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107782951)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449257.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF13410.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;