| Transcript | Ll_transcript_67927 |
|---|---|
| CDS coordinates | 270-617 (+) |
| Peptide sequence | MLKLYGLDAKVEKICPLTFKEPSEVIRVCRNVADPSCCNSLHTYIAWLQKQMLITNKQAILCATLFGSMLRKGGVLTNVYELCDIDLKDFSLPGICRIPLIDILIFLGQPFFYFL* |
| ORF Type | complete |
| Blastp | Uncharacterized GPI-anchored protein At1g61900 from Arabidopsis with 41.3% of identity |
|---|---|
| Blastx | Uncharacterized GPI-anchored protein At1g61900 from Arabidopsis with 41.3% of identity |
| Eggnog | NA(ENOG410YBW4) |
| Kegg | Link to kegg annotations (AT1G61900) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450846.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer