Protein coding transcript 191182

• Transcript: Ll_transcript_67977
• CDS coordinates: 932-2011 (+)
• Peptide sequence: MWRKRLIQRDMPALRFKTCRLLLGNVWNRELTIIQRRILRRLRNKKRSIKRKIYSRENLNSYIQLQTTRKLSLFYGDLPITEMHRGTERTSYIPFLLNLETRLDVILVRLHFCETIPQARQLISHRRVCVNNRMVSISPLKVSHGDLISFQENDARIRGEEIRRSFYIEILVEKIIGKFLDHPVRMWRRTKTEWFHLLKTKRGCRLLLKSRFLQQQLRYSMQEEYLERTKKVGSEKVCLGSSFAEHNRMKRNLYHLKSIFLSKRRNDKNRNLPTRTRSPLVYNSSLYSNSTYCSASPHQFTMKRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI*
• ORF Type: complete

Annotations of Ll_transcript_67977

• Blastp: Ribosomal protein S4, mitochondrial from Arabidopsis with 83.01% of identity
• Blastx: Ribosomal protein S4, mitochondrial from Arabidopsis with 82.74% of identity
• Eggnog: ribosomal protein S4(ENOG410YEHI)
• Kegg: Link to kegg annotations (ArthMp027)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421110.1)
• Pfam: S4 domain (PF01479.24)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;