Transcript | Ll_transcript_67983 |
---|---|
CDS coordinates | 771-1850 (+) |
Peptide sequence | MWRKRLIQRDMPALRFKTCRLLLGNVWNRELTIIQRRILRRLRNKKRSIKRKIYSRENLNSYIQLQTTRKLSLFYGDLPITEMHRGTERTSYIPFLLNLETRLDVILVRLHFCETIPQARQLISHRRVCVNNRMVSISPLKVSHGDLISFQENDARIRGEEIRRSFYIEILVEKIIGKFLDHPVRMWRRTKTEWFHLLKTKRGCRLLLKSRFLQQQLRYSMQEEYLERTKKVGSEKVCLGSSFAEHNRMKRNLYHLKSIFLSKRRNDKNRNLPTRTRSPLVYNSSLYSNSTYCSASPHQFTMKRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI* |
ORF Type | complete |
Blastp | Ribosomal protein S4, mitochondrial from Arabidopsis with 83.01% of identity |
---|---|
Blastx | Ribosomal protein S4, mitochondrial from Arabidopsis with 82.74% of identity |
Eggnog | ribosomal protein S4(ENOG410YEHI) |
Kegg | Link to kegg annotations (ArthMp027) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421110.1) |
Pfam | S4 domain (PF01479.24) |
Rfam | Intron_gpII (RF00029) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer