Transcript | Ll_transcript_69670 |
---|---|
CDS coordinates | 94-543 (+) |
Peptide sequence | MAPTKQRTARVTRNPELIRGIGKYSRSQVYHKRGLWAIKAKNGGVLPRHAPKAKPAVPAEKAPKFYPADDVKKPRLNKHKPRPTKLRASITPGTVLILLAGHFKGKRVVFLKQLPSGLLLVTGKLFGDNFFDIVLILCFNNLCWPSCFS* |
ORF Type | complete |
Blastp | 60S ribosomal protein L6 from Cryophytum with 78.86% of identity |
---|---|
Blastx | 60S ribosomal protein L6 from Cryophytum with 78.86% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430234.1) |
Pfam | Ribosomal protein L6, N-terminal domain (PF03868.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer