Protein coding transcript 191194

• Transcript: Ll_transcript_69666
• CDS coordinates: 1106-1474 (+)
• Peptide sequence: MFMSLPLIGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYFSKATQKKKKKGEGEFFEAEKEVSLSEFQVWLMFSLLFSVVLIYVAFFPNVGEKCVSSREKGCPKNCGRHFAKSH*
• ORF Type: complete

Annotations of Ll_transcript_69666

• Blastp: 60S ribosomal protein L6 from Cryophytum with 80% of identity
• Blastx: 60S ribosomal protein L6-1 from Arabidopsis with 78.72% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426305.1)
• Pfam: Ribosomal protein L6e (PF01159.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;