Protein coding transcript 1912

• Transcript: Ll_transcript_432287
• CDS coordinates: 108-725 (+)
• Peptide sequence: MDNKGHQSQTFFTTNTNNAPSCYTNGPYLRQLNKNSNKISKPISKILPKNIPITKKQLDDYENMFTQLNPPPLVYKIKKSEFKEFVQKVTGCTPKVTTAQPPSIKQPNPPNTLCFRRQPPPPNTTFHGSNNPINHINNDIVVAPQPMFPQASSYPSVSVGAESPINPYMWFVNNTVMSSQIPLMYPNVLFPHDQVGFPRWNDVQI*
• ORF Type: complete

Annotations of Ll_transcript_432287

• Blastp: VQ motif-containing protein 9 from Arabidopsis with 27.54% of identity
• Blastx: -
• Eggnog: VQ motif(ENOG410Z611)
• Kegg: Link to kegg annotations (AT1G78310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416946.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;