Protein coding transcript 19121

• Transcript: Ll_transcript_418489
• CDS coordinates: 272-640 (+)
• Peptide sequence: MLGHFLDILVLRYCAVAPTILAGQIDPLLFEALYASQHAIFLFARIPQIWQNFSNKSTGELSFLTSFMNFGGSMVRVFTSIQENAPKSVLLGSVIGIATNFTILSQILIYQKPQAGKEKKTK*
• ORF Type: complete

Annotations of Ll_transcript_418489

• Blastp: Mannose-P-dolichol utilization defect 1 protein homolog 2 from Arabidopsis with 76% of identity
• Blastx: Mannose-P-dolichol utilization defect 1 protein homolog 2 from Arabidopsis with 76% of identity
• Eggnog: MannoseP-dolichol utilization defect 1(ENOG4111FE3)
• Kegg: Link to kegg annotations (AT4G07390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436930.1)
• Pfam: PQ loop repeat (PF04193.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;