Protein coding transcript 191292

• Transcript: Ll_transcript_68478
• CDS coordinates: 297-662 (+)
• Peptide sequence: MAFSSSMVSLFILLILSLLQLPSFSYGSSSPLCLLEPSSFLYNLQSQCPFLIQSNPPLKVDGNFIEGVLSGRKRIGYISILFYASWCPFSRRMLPEFETLSSMFPRVEHLTLEQSSALPRL*
• ORF Type: complete

Annotations of Ll_transcript_68478

• Blastp: 5'-adenylylsulfate reductase-like 5 from Arabidopsis with 38.98% of identity
• Blastx: 5'-adenylylsulfate reductase-like 5 from Arabidopsis with 46.15% of identity
• Eggnog: thioredoxin domain containing 15(ENOG4111M6Z)
• Kegg: Link to kegg annotations (AT3G03860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442884.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;