Transcript | Ll_transcript_67445 |
---|---|
CDS coordinates | 2528-2836 (+) |
Peptide sequence | MNQLSSYLFIFQLVFGGEREIASGTIPDPGSLKASDITMLDVPVKVAHSILLSLARDIGTDWDIDYQLDIYLIIDLPVIGNFTIPLSQKGEFKLPTFSDIFA* |
ORF Type | complete |
Blastp | Desiccation protectant protein Lea14 homolog from Soja with 86.9% of identity |
---|---|
Blastx | Desiccation protectant protein Lea14 homolog from Soja with 86.9% of identity |
Eggnog | late embryogenesis abundant protein(ENOG4111PUK) |
Kegg | Link to kegg annotations (547837) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415888.1) |
Pfam | Late embryogenesis abundant protein (PF03168.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer