Protein coding transcript 191411

• Transcript: Ll_transcript_69484
• CDS coordinates: 1-669 (+)
• Peptide sequence: GVHSRLDPLQLLLKGVSDRGAKRVRVHILTDGRDVLDGSSVGFVETLEHDLSELRNKGIDARIASGGGRMHVTMDRYENDWNVVKRGWDAQVLGEAPYKFTDALEAVKKLRAEQQPKPNDQYLPAFVIVDENGKPVGPIVDGDAVVTLNYRADRMVMLAKALEYEDFDKFDRVRFPKINYAGMLEYDGELKLPSHYLVSPPEIDRTSGEYLVKNGIRTFACR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69484

• Blastp: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase from Cryophytum with 85.07% of identity
• Blastx: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase from Cryophytum with 85.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427321.1)
• Pfam: BPG-independent PGAM N-terminus (iPGM_N) (PF06415.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;