Protein coding transcript 191414

• Transcript: Ll_transcript_69488
• CDS coordinates: 86-1471 (+)
• Peptide sequence: MASSGKHTSQFSWKLEDHPKLPKGKPIAVIVLDGWGEASPNEYNCIHTAETPKMDSLKNGAPDLWRLVKAHGTAVGLPSDDDMGNSEVGHNALGAGRIFSQGAKLVDSALASGKIYEEPGFKYIQESFQTGTLHLIGLLSDGGVHSRLDQLQLLLKGVSDRGAKRVRVHILTDGRDVLDGSSVGFVETLEHDLSELRNKGIDARIASGGGRMHVTMDRYENDWNVVKRGWDAQVLGEAPYKFTDALEAVKKLRAEQQPKPNDQYLPAFVIVDENGKPVGPIVDGDAVVTLNYRADRMVMLAKALEYEDFDKFDRVRFPKINYAGMLEYDGELKLPSHYLVSPPEIDRTSGEYLVKNGIRTFACSETVKFGHVTFFWNGNRSGYFNPELEKYVEVPSDSGITFNVQPKMKALEIAEKARDAILSGNFDQVRVNLPNSDMVGHTGDIDATVVACKAADEAVKV*
• ORF Type: complete

Annotations of Ll_transcript_69488

• Blastp: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase from Cryophytum with 84.58% of identity
• Blastx: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase from Cryophytum with 82.48% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427321.1)
• Pfam: Metalloenzyme superfamily (PF01676.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;