Protein coding transcript 191532

• Transcript: Ll_transcript_67786
• CDS coordinates: 1-477 (+)
• Peptide sequence: YTERIKEKTMADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_67786

• Blastp: Calmodulin from Medicago with 100% of identity
• Blastx: Calmodulin from Medicago with 100% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004491196.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;