Protein coding transcript 191567

• Transcript: Ll_transcript_68840
• CDS coordinates: 115-699 (+)
• Peptide sequence: MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQDVKQEAHKAQTLVAGRILIMITRKLEQML*
• ORF Type: complete

Annotations of Ll_transcript_68840

• Blastp: RCC1 and BTB domain-containing protein 2 from Mus with 30.77% of identity
• Blastx: Ultraviolet-B receptor UVR8 from Arabidopsis with 41.07% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (105670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460943.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF13540.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;