Protein coding transcript 1916

• Transcript: Ll_transcript_432240
• CDS coordinates: 3-527 (+)
• Peptide sequence: DLPQMKEMLAKYKLDNTNFSALRLSSSACVAFPTCGLAMAESERYLPVLISKLESTIEEAGLRQDSIVMRMTGCPNGCARPWLAEVAFVGKAFGAYNMYLGGGYHGQRLNKLYRSSIKEEEILDILKPLIKRYAAERNDGERFGDFAIRIGMIKPTLEGKVFHEDTAELEEEDE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_432240

• Blastp: Sulfite reductase [NADPH] subunit beta from Saccharomyces with 68.29% of identity
• Blastx: Sulfite reductase [NADPH] subunit beta from Saccharomyces with 68.55% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YJR137C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412678.1)
• Pfam: Nitrite and sulphite reductase 4Fe-4S domain (PF01077.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;