Protein coding transcript 191642

• Transcript: Ll_transcript_68669
• CDS coordinates: 2063-2569 (+)
• Peptide sequence: MQPHTTHLDHHTLKLLKSWTWQFVVLRPVCSIVMIALQYFEVYPTWVSWTLTIILNLSVSLALYSLVVFYHVFSKELAPHKPLAKFLCIKGIVFFCFWQGIVLNLLVKIGIIQSRFSWLPVERIEEGYQNILVCFEMVFFSIYQSSAYSVAPYKVDNRTGETTDKKSK*
• ORF Type: complete

Annotations of Ll_transcript_68669

• Blastp: Transmembrane protein 184C from Bos with 35.53% of identity
• Blastx: Transmembrane protein 184C from Bos with 35.53% of identity
• Eggnog: transmembrane protein 184B(ENOG410XQ3V)
• Kegg: Link to kegg annotations (504966)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453606.1)
• Pfam: Organic solute transporter Ostalpha (PF03619.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;