Protein coding transcript 191645

• Transcript: Ll_transcript_68672
• CDS coordinates: 581-883 (+)
• Peptide sequence: MDPEQIILWGSTLCIIIAVHFSMKLLSEHVLNWKRPKEQKAIVIIILMAPLYAVDSYVGLINFFGSEAFFTFLDSIKECYEALVRFSYMEIGMFITFIVI*
• ORF Type: complete

Annotations of Ll_transcript_68672

• Blastp: Protein LAZ1 homolog 1 from Arabidopsis with 35.16% of identity
• Blastx: Protein LAZ1 homolog 1 from Arabidopsis with 34.04% of identity
• Eggnog: transmembrane protein 184B(ENOG410XQ3V)
• Kegg: Link to kegg annotations (AT1G77220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449132.1)
• Pfam: Organic solute transporter Ostalpha (PF03619.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;