Protein coding transcript 191649

• Transcript: Ll_transcript_68677
• CDS coordinates: 941-1501 (+)
• Peptide sequence: MYSYLNISLSKNIVPDEIKGREIHHSFPMTLFQPHTTHLDHHTLKLLKSWTWQFVVLRPVCSIVMIALQYFEVYPTWVSWTLTIILNLSVSLALYSLVVFYHVFSKELAPHKPLAKFLCIKGIVFFCFWQGIVLNLLVKIGIIQSRFSWLPVERIEEGYQNILVCFEMVFFSIYQSSAYSVAPYKVD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_68677

• Blastp: Transmembrane protein 184 homolog DDB_G0279555 from Dictyostelium with 39.49% of identity
• Blastx: Transmembrane protein 184C from Bos with 28.19% of identity
• Eggnog: transmembrane protein 184B(ENOG410XQ3V)
• Kegg: Link to kegg annotations (DDB_G0279555)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449132.1)
• Pfam: Organic solute transporter Ostalpha (PF03619.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;