Transcript | Ll_transcript_68655 |
---|---|
CDS coordinates | 1766-2272 (+) |
Peptide sequence | MQPHTTHLDHHTLKLLKSWTWQFVVLRPVCSILMITLQYFEVYPSWVDWTITIVLNISVSLALYSLVVFYHVFAKELEPHKPLAKFLCIKGIVFFCFWQGIVLNLLTKFGIIRSRFAWLPVERIEEGYQNILVCLEMVFFSIYQMSAYSVAPYKVDDKASVTSDKKSK* |
ORF Type | complete |
Blastp | Transmembrane protein 184 homolog DDB_G0279555 from Dictyostelium with 36.69% of identity |
---|---|
Blastx | Transmembrane protein 184 homolog DDB_G0279555 from Dictyostelium with 37.42% of identity |
Eggnog | transmembrane protein 184B(ENOG410XQ3V) |
Kegg | Link to kegg annotations (DDB_G0279555) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453606.1) |
Pfam | Organic solute transporter Ostalpha (PF03619.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer