Protein coding transcript 191674

• Transcript: Ll_transcript_67615
• CDS coordinates: 1-453 (+)
• Peptide sequence: QMPGMKPGPDSIGIVAISHGCPGVAARACGLVGLEPARVSSLILVITGSNSFETEKMMCAQVAEILKDRLSWFRDCRTVDVLNMMPTANGGTIELLYMQLYAPTTLAPGRDFWLLRYTSLLEDGSLVVCNSNVVLLCLPTYEAYVGSAQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_67615

• Blastp: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 69.17% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 70.16% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410XQ3R)
• Kegg: Link to kegg annotations (AT1G52150)
• CantataDB: -
• Mirbase: far-MIR166 (MI0016616)
• Ncbi protein: Link to NCBI protein (XP_019417531.1)
• Pfam: START domain (PF01852.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;