Protein coding transcript 191726

• Transcript: Ll_transcript_67731
• CDS coordinates: 3-626 (+)
• Peptide sequence: VTLLTMAEQTEKAFLKQPKVFLRYAIVTRKMLHFFFHSFGFWCIIVCYFDSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRIIAGTVHSAKMTRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRLGFYMRNLFLSLLHVEFIVACHIYSTVSLSFLSAIYRPISKTVRF
• ORF Type: internal

Annotations of Ll_transcript_67731

• Blastp: 40S ribosomal protein S11 from Soja with 76.58% of identity
• Blastx: 40S ribosomal protein S11 from Soja with 71.52% of identity
• Eggnog: One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal(COG0186)
• Kegg: Link to kegg annotations (547984)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414404.1)
• Pfam: Ribosomal_S17 N-terminal (PF16205.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;