Protein coding transcript 191774

• Transcript: Ll_transcript_68725
• CDS coordinates: 2-445 (+)
• Peptide sequence: REQKTMAGRLTNAASRILGGNGVVSRSVASSLRLRSGMGLPVGKHIVPDKPLPASDELVWDNGTPYPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGMLAVWNDKASKIPFVSASVFRHLAFVISLTYYLSIRLICFDLSSVEVIM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_68725

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Arabidopsis with 82.41% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Arabidopsis with 83.18% of identity
• Eggnog: NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 8(ENOG410YKP2)
• Kegg: Link to kegg annotations (AT5G47570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453397.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;