Protein coding transcript 1918

• Transcript: Ll_transcript_432283
• CDS coordinates: 3-368 (+)
• Peptide sequence: LLNLFSRAGLSMDHELFEEDMLDKATKAILKTRDGLLRAAVPNPIGTCVFLNDVSPEEMNKALRRHKELMKEYPLEGAGLDAFVDASDTGYTMNDKPIEDAMHESKKTMNGMSNGAVNGTAK
• ORF Type: internal

Annotations of Ll_transcript_432283

• Blastp: Demethyl-4-deoxygadusol synthase from Anabaena with 53.01% of identity
• Blastx: Demethyl-4-deoxygadusol synthase from Anabaena with 53.01% of identity
• Eggnog: 3-dehydroquinate synthase(COG0337)
• Kegg: Link to kegg annotations (Ava_3858)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004512152.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;