Protein coding transcript 191892

• Transcript: Ll_transcript_69275
• CDS coordinates: 262-564 (+)
• Peptide sequence: MVHVLHHLSSLFAEFGTSYFVFIFLEMALTGKISTEIPIQAPPSKWFNLFAKQLHDVQHHAERVHQTKLHEGEDWHHNDTIKHWTYEIDGKVVACKEKIVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_69275

• Blastp: MLP-like protein 43 from Arabidopsis with 36.99% of identity
• Blastx: -
• Eggnog: response to biotic stimulus(ENOG4111C37)
• Kegg: Link to kegg annotations (AT1G70890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458779.1)
• Pfam: Pathogenesis-related protein Bet v I family (PF00407.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;