Protein coding transcript 191895

• Transcript: Ll_transcript_69265
• CDS coordinates: 23-484 (+)
• Peptide sequence: MALTGKLSTEIPIQAPPSKWFQLFAKQLHDVQHHAERVHHTKLHEGEDWHHNDTIKHWTYEIDGKVVACKEKIVSYDEEKKTIKYALFDGDFTPYYKDFTLIFRVIEKEDGSAFVNFAIEYEKKDDSVPEPPHGYAEYLAKFSRDIDANLLKA*
• ORF Type: complete

Annotations of Ll_transcript_69265

• Blastp: MLP-like protein 31 from Arabidopsis with 34.21% of identity
• Blastx: MLP-like protein 31 from Arabidopsis with 34.21% of identity
• Eggnog: response to biotic stimulus(ENOG4111C37)
• Kegg: Link to kegg annotations (AT1G70840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458779.1)
• Pfam: Pathogenesis-related protein Bet v I family (PF00407.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;