Transcript | Ll_transcript_432288 |
---|---|
CDS coordinates | 2-331 (+) |
Peptide sequence | GGFWIGLAIILIPGGFEVESAYSTAIDFYAAFALYIFAWFIFTFLLWILTLRSTLAFSSLFFMVWMAFIFLGTAYLDARNTADGHPHHGLTVAGGVFGMIAAFIAWYNML |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Meiotically up-regulated gene 86 protein from Schizosaccharomyces with 44.55% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC5D6.09c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020203710.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer