Protein coding transcript 191980

• Transcript: Ll_transcript_66897
• CDS coordinates: 1940-2359 (-)
• Peptide sequence: MPLCCEEVQPQNSIKVLCSGETDLRDGIPISSSQINTEDSKHPLPSKSSEQLEAISGVNFANHQSIKSLKDSRFDYFKTWSGKLEKQFSILSGRSPALTVEEDSGIRNTDRPLPVSRYFDALEGPELETLRVCNYLLPI*
• ORF Type: complete

Annotations of Ll_transcript_66897

• Blastp: S-type anion channel SLAH3 from Arabidopsis with 50.62% of identity
• Blastx: S-type anion channel SLAH3 from Arabidopsis with 61.79% of identity
• Eggnog: C4-dicarboxylate transporter malic acid transport protein(ENOG4111I0D)
• Kegg: Link to kegg annotations (AT5G24030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427718.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;