Transcript | Ll_transcript_66901 |
---|---|
CDS coordinates | 1940-2359 (-) |
Peptide sequence | MPLCCEEVQPQNSIKVLCSGETDLRDGIPISSSQINTEDSKHPLPSKSSEQLEAISGVNFANHQSIKSLKDSRFDYFKTWSGKLEKQFSILSGRSPALTVEEDSGIRNTDRPLPVSRYFDALEGPELETLRVCNYLLPI* |
ORF Type | complete |
Blastp | S-type anion channel SLAH3 from Arabidopsis with 50.62% of identity |
---|---|
Blastx | S-type anion channel SLAH3 from Arabidopsis with 61.79% of identity |
Eggnog | C4-dicarboxylate transporter malic acid transport protein(ENOG4111I0D) |
Kegg | Link to kegg annotations (AT5G24030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427718.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer