Protein coding transcript 1921

• Transcript: Ll_transcript_432215
• CDS coordinates: 99-875 (+)
• Peptide sequence: MPCFFKLFFLFSLFFRFSFSHDTNLLPRPLILEYSDLVGEELKLRCRSWRVAGEANNLSPWKTIPEECEEYVKEYMVGRSYAFDLELVSKEAEDYAKTVKLNDDGKDAWIFDIDETLLSNIPYYADHRFGLELFDHEEFNKWVEKGMAPAIIPSLKLYEDVLNLGFKVILLTGRSERHRSVTVDNLISAGFRDWDQLILRTSEDHAKLATVYKSEKRSEMEKDGYRIHGNSGDQWSDLLGFSLSVRSFKLPNPMYYIP*
• ORF Type: complete

Annotations of Ll_transcript_432215

• Blastp: Acid phosphatase 1 from Lycopersicon with 66.39% of identity
• Blastx: Acid phosphatase 1 from Lycopersicon with 66.39% of identity
• Eggnog: Acid phosphatase(ENOG410YBHH)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464951.1)
• Pfam: HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;