Protein coding transcript 192186

• Transcript: Ll_transcript_66954
• CDS coordinates: 509-1291 (+)
• Peptide sequence: MLVVSMVAPAVQQHAAPVSTPRKKMTKQLTGKKDDNPLHSAARAGHLAVLKDIFANAEDDELRELMAKQNQDGETALYVAAEYGYVDVVREMIQYYDLVDAGIKARNGFDALHIAAKQGDLDVLKILMEAHPELSMTVDPSNTTALHTAAAQGHIEVVKFLLEAGSSLATIAKSNGKTALHSAARNGHLEVVKALIQKDPLASTRTDKKGQTALHMAVKGQNLVVVEELIKADPSLINIVDTKGNAALHIAARKGRSQVN*
• ORF Type: complete

Annotations of Ll_transcript_66954

• Blastp: Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 61.34% of identity
• Blastx: Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 59.73% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G02620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436236.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;