Protein coding transcript 1922

• Transcript: Ll_transcript_432202
• CDS coordinates: 2-475 (+)
• Peptide sequence: SLADIAVTCTLLHLYQYVLDPNFRKPYQNVNRWFTTIVNQPQVKAVIGEFKLCEKQAEFDPKKFAELQALNKPAGAADKKDNKKKDAPKKAEKEKKETPKKAEKEEDLDACEAALAEEPKSKDPFDLMPKGTFNMDDFKRCYSNEDESKSIAYFWEKF
• ORF Type: internal

Annotations of Ll_transcript_432202

• Blastp: Elongation factor 1-gamma from Artemia with 66.67% of identity
• Blastx: Elongation factor 1-gamma from Artemia with 64.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015937511.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF00043.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;