Transcript | Ll_transcript_66947 |
---|---|
CDS coordinates | 399-1181 (+) |
Peptide sequence | MLVVSMVAPAVQQHAAPVSTPRKKMTKQLTGKKDDNPLHSAARAGHLAVLKDIFANAEDDELRELMAKQNQDGETALYVAAEYGYVDVVREMIQYYDLVDAGIKARNGFDALHIAAKQGDLDVLKILMEAHPELSMTVDPSNTTALHTAAAQGHIEVVKFLLEAGSSLATIAKSNGKTALHSAARNGHLEVVKALIQKDPLASTRTDKKGQTALHMAVKGQNLVVVEELIKADPSLINIVDTKGNAALHIAARKGRSQVN* |
ORF Type | complete |
Blastp | Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 61.34% of identity |
---|---|
Blastx | Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 59.73% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT5G02620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436236.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer