Protein coding transcript 192208

• Transcript: Ll_transcript_69213
• CDS coordinates: 1880-2206 (+)
• Peptide sequence: MEAAKVFKYSGREFGASVCFGFFAVSWLVLRLIFFPFWVIRATSIDLQKCLNLAETFPMFLYYTFNTLLIMLLIFHIYWWMLICAMINRQLKNRGKVGEDIRSDSDDD*
• ORF Type: complete

Annotations of Ll_transcript_69213

• Blastp: LAG1 longevity assurance homolog 2 from Arabidopsis with 71.3% of identity
• Blastx: LAG1 longevity assurance homolog 2 from Arabidopsis with 74.8% of identity
• Eggnog: ceramide synthase(COG5058)
• Kegg: Link to kegg annotations (AT3G19260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421413.1)
• Pfam: TLC domain (PF03798.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;